Resonance Assignment/Abacus/Protein Sequence format

From Wiki

Share/Save/Bookmark< Resonance Assignment | Abacus(Redirected from Protein Sequence format)
Jump to: navigation, search

Contents


1. Fasta format.

The first line should start with '>' symbol.

Next one or more lines contain sequence in 1-letter code.


Example 1.1:

>
MDSKEVLVHVKNLEKNKSNDAAVLEILHVLDKEFVPTE
KLLRETKVGVEVNKFKKSTNVEISKLVKKMISSWKD 


2. "Standard" format.

Each line contains name of one residue in 3-letter code and, optionally, the residue ID.

(Only residue ID of the first residue is used to start numbering of sequence positions.


Example 2.1. (position ID is not specified):

GLN 
GLY 
HIS 
MET 
PRO 
GLY 
ILE 
ILE 
TYR 
GLU 
GLY 
.... 

Example 2.2. (with specified all position ID):

GLN  -3
GLY  -2 
HIS  -1 
MET   0 
PRO   1 
GLY   2 
ILE   3 
ILE   4 
TYR   5 
..... 

Example 2.3. (with specified first position ID):

GLN  -3
GLY  
HIS
MET
PRO
GLY
ILE
.....
Personal tools